PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp1g17600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family SRS
Protein Properties Length: 353aa    MW: 38807.3 Da    PI: 7.042
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp1g17600genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702224.52e-691192793154
     DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasa.......aeaaskrkrel....kskkqsalsstkl 91 
                 g+++CqdCGnqakkdC h+RCRtCCksrgfdC+thvkstWvpaakrrerq+qla++ +k+++++       +++  ++++ +         sal++ +l
  Tp1g17600 119 PGNMNCQDCGNQAKKDCPHMRCRTCCKSRGFDCQTHVKSTWVPAAKRRERQAQLATLPAKRSRETssgrgddDDDGDREDN-EnggqGGGGGSALACIRL 217
                5899***************************************************99888877776788764222222222.23544456779999***9 PP

     DUF702  92 ssaeskkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                ++a+s+  le s+lP+e+ss+avfrc+rvss+d ++ee+aYqtavsigGhvfkGiLydqG+++
  Tp1g17600 218 VNASSS-GLENSHLPPEISSPAVFRCMRVSSMDHEDEEYAYQTAVSIGGHVFKGILYDQGPSD 279
                999765.999999***********************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.1E-63121278IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016231.2E-27123165IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016243.2E-25229277IPR006511Lateral Root Primordium type 1, C-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009299Biological ProcessmRNA transcription
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MAGLFYLGGR DNNKQDHQHH HQDKDHNEDK RNNYLYLYKD EIYNNNNKGF EIWPPQYFQQ  60
QQQQQNHVAP PTNFYSFGMV PNGGSNTNNR SSNRSLCFNV VSDHEPVGSS TGRFTVTRPG  120
NMNCQDCGNQ AKKDCPHMRC RTCCKSRGFD CQTHVKSTWV PAAKRRERQA QLATLPAKRS  180
RETSSGRGDD DDDGDREDNE NGGQGGGGGS ALACIRLVNA SSSGLENSHL PPEISSPAVF  240
RCMRVSSMDH EDEEYAYQTA VSIGGHVFKG ILYDQGPSDY NRYSSSPAAA APETSQHHIN  300
LFTSSASAAT TTAVTASNIY NASVDPSTLY TAATAPFNGF ITAGTHFFAP PRS
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00152DAPTransfer from AT1G19790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2052680.0GU205268.1 Brassica rapa subsp. pekinensis short internode related sequence 7 (SRS7) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009149464.10.0PREDICTED: protein SHI RELATED SEQUENCE 7
RefseqXP_009149465.10.0PREDICTED: protein SHI RELATED SEQUENCE 7
RefseqXP_013641856.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
RefseqXP_013641857.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
RefseqXP_013641858.10.0PREDICTED: protein SHI RELATED SEQUENCE 7-like
SwissprotQ9FXH70.0SRS7_ARATH; Protein SHI RELATED SEQUENCE 7
TrEMBLA0A078GW490.0A0A078GW49_BRANA; BnaA06g13970D protein
TrEMBLA0A078JKD90.0A0A078JKD9_BRANA; BnaCnng57210D protein
TrEMBLD2KC770.0D2KC77_BRARP; Short internode related sequence 7
STRINGBra025768.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26452572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19790.21e-146SHI-related sequence 7